Protein Info for LU632_RS17295 in Erwinia tracheiphila SCR3

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF00126: HTH_1" amino acids 5 to 64 (60 residues), 66.4 bits, see alignment E=1.7e-22 PF03466: LysR_substrate" amino acids 86 to 288 (203 residues), 171 bits, see alignment E=2.3e-54

Best Hits

Swiss-Prot: 78% identical to YEIE_ECOL6: Uncharacterized HTH-type transcriptional regulator YeiE (yeiE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 85% identity to ebi:EbC_29970)

Predicted SEED Role

"LysR family transcriptional regulator YeiE" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>LU632_RS17295 LysR family transcriptional regulator (Erwinia tracheiphila SCR3)
MHITLRQLEVFTEVLKSGSTTQAAQQLSLSQSAVSAALADLEGQLNVQLFDRVGKRLVVN
EHGRLLYPRAMALLDQAGEIEQLFHEDKGALRVFASSTIGNYMLPGMIARWRRDYPDLPL
ELSVGNSQDVINAVADFRVDIGLIEGPCHTNELISEAWLEDDLVVFAAPDASVLNRPVTL
ESLASAMWILREQGSGTREIVDYLLLSHLPSFRLALELGNSEAIKHAVRHGMGISCLSRR
VIEEQLHSGTLCEVPLPMPALKRTLYRVHHRQKHLSRPLLRFLSYCNEKP