Protein Info for LU632_RS16170 in Erwinia tracheiphila SCR3

Name: pgm
Annotation: phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01132: phosphoglucomutase, alpha-D-glucose phosphate-specific
  • amino acids 1 to 544 (544 residues), 1019.8 bits, E=0
• PF02878: PGM_PMM_I
  • amino acids 40 to 179 (140 residues), 112.1 bits, E=3.5e-36
• PF02879: PGM_PMM_II
  • amino acids 210 to 317 (108 residues), 58.5 bits, E=1.7e-19
• PF02880: PGM_PMM_III
  • amino acids 320 to 440 (121 residues), 103.4 bits, E=1.7e-33
• PF00408: PGM_PMM_IV
  • amino acids 489 to 536 (48 residues), 27.6 bits, 4.9e-10

Best Hits

Swiss-Prot: 87% identical to PGM_ECOLI: Phosphoglucomutase (pgm) from Escherichia coli (strain K12)

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 93% identity to ebi:EbC_12800)

MetaCyc: 87% identical to phosphoglucomutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (1/4 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• glycogen degradation II (2/6 steps found)
• colanic acid building blocks biosynthesis (5/11 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• glycogen degradation I (2/8 steps found)
• starch biosynthesis (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Protein Sequence (546 amino acids)

>LU632_RS16170 phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (Erwinia tracheiphila SCR3)
MANHPRAGQPARQSDLINVAQLTSQYYVLQPDPGNAEHAVKFGTSGHRGSAGRHSFNETH
ILAIVQAIAEERKKNGITGPCYVGKDTHALSEPAIISVLEVLAANGVDVIVQQDNGYTPT
PAISNAILEHNKAGGMQADGIVITPSHNPPEDGGIKYNPPNGGPADTNVTKVVEERANAL
IKEGLQGVRRIALDKAWASGHLTEQDLVQPYIEGLTQVIDIKAIKKAGLKIGVDPLGGSG
IAYWQRIAEFYNLDLTIVNDSIDQTFRFMHLDKDGVIRMDCSSESAMAGLLALRDQFDLA
FANDPDYDRHGIVTPSGLMNPNHYLAVAINYLFQNRPQWGKDVAVGKTLVSSAMIDRVVK
AIDRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLRFDGTPWSTDKDGIILCLLAAE
ITAVTGKNPQQHYDELAERFGAPSYNRQQASATSAQKAALSRLSPEMVSADILAGDPITA
RLTSAPGNGASIGGLKVMTENGWFAARPSGTEDAYKIYCESFLGAEHREKIEKEAVEIVS
EVLKNA