Protein Info for LU632_RS15230 in Erwinia tracheiphila SCR3

Name: cysS
Annotation: cysteine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 TIGR00435: cysteine--tRNA ligase" amino acids 2 to 462 (461 residues), 629.2 bits, see alignment E=2.6e-193 PF01406: tRNA-synt_1e" amino acids 15 to 314 (300 residues), 482 bits, see alignment E=1.6e-148 PF09334: tRNA-synt_1g" amino acids 36 to 106 (71 residues), 24.9 bits, see alignment E=1.7e-09 amino acids 253 to 298 (46 residues), 24.9 bits, see alignment 1.7e-09 PF09190: DALR_2" amino acids 342 to 403 (62 residues), 87.8 bits, see alignment E=1.1e-28

Best Hits

Swiss-Prot: 81% identical to SYC_ERWT9: Cysteine--tRNA ligase (cysS) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 84% identity to ebi:EbC_11250)

MetaCyc: 78% identical to cysteine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Cysteine--tRNA ligase. [EC: 6.1.1.16]

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>LU632_RS15230 cysteine--tRNA ligase (Erwinia tracheiphila SCR3)
MLKIFNTLSRQKEEFKPINAGQIGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYS
LKYVRNITDIDDKIIKRANENQQSIQQLTDTMIAEMHRDFAALNILPPDAEPRATQHIDD
IIALVSKLIEHQHAYVASNGDVMFSVESDADYGLLSRQDLEQLQAGARVEVAADVKRNPM
DFVLWKMSKAHEPGWPSPWGEGRPGWHIECSAMNYKQLGEHFDIHGGGSDLMFPHHENEI
AQSSCAHDGPYVNYWMHSGMVMVDREKMSKSLNNFFTVRDVLAHYDPETVRYFLMSGHYR
SQLNYGEDNLKQARAGLERLYTALRNTDVSVEACGGESFEARFREAMNDDFNTPEAYSVL
FDMAREVNRLKMEDAVSANGLAAKMRQLAGVLGLLKQDPASFLQNTGSDGANDEVAEIEA
LIKMRNDARKEKNWSQADVARDKLNALGIILEDGPQGSIWRRK