Protein Info for LU632_RS14805 in Erwinia tracheiphila SCR3

Name: pabC
Annotation: aminodeoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03461: aminodeoxychorismate lyase
  • amino acids 2 to 260 (259 residues), 360.9 bits, E=1.6e-112
• PF01063: Aminotran_4
  • amino acids 23 to 246 (224 residues), 164 bits, E=2.6e-52

Best Hits

Swiss-Prot: 58% identical to PABC_ECOLI: Aminodeoxychorismate lyase (pabC) from Escherichia coli (strain K12)

KEGG orthology group: K02619, 4-amino-4-deoxychorismate lyase [EC: 4.1.3.38] (inferred from 65% identity to ebi:EbC_16580)

MetaCyc: 58% identical to aminodeoxychorismate lyase (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate lyase. [EC: 4.1.3.38]

Predicted SEED Role

"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)

MetaCyc Pathways

• superpathway of chorismate metabolism (50/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• 4-aminobenzoate biosynthesis II (1/2 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.38

Protein Sequence (264 amino acids)

>LU632_RS14805 aminodeoxychorismate lyase (Erwinia tracheiphila SCR3)
MWVNGQLQDNVAIGDRAVQFGDGCFTTAHISQSEVKALDAHLMRLQLGCERLLIESVDWQ
RLREEMLNAAVGHSEAVLKVIISRGKGGRGYSASGCGQPTRILTVSDYPGHYYHLKVTGV
SLQLSSIRLARNPFLAGIKHLNRLEQVLIRAELEQTDADEALVLDTEGMLVECCAANLFW
RKGNDVFTPCLSDSGVNGIQRQQVIKLLRETGTIVSEVRNSPDVLQEADEVLITNALMPV
LPVRQISQHFYHDRNLYNFLISRI