Protein Info for LU632_RS14765 in Erwinia tracheiphila SCR3

Name: lpoB
Annotation: penicillin-binding protein activator LpoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02722: uncharacterized lipoprotein
  • amino acids 2 to 187 (186 residues), 153.9 bits, E=2.6e-49
• PF13036: LpoB
  • amino acids 49 to 185 (137 residues), 111.4 bits, E=1.9e-36

Best Hits

Swiss-Prot: 69% identical to LPOB_ERWAC: Penicillin-binding protein activator LpoB (lpoB) from Erwinia amylovora (strain CFBP1430)

KEGG orthology group: K07337, hypothetical protein (inferred from 75% identity to ebi:EbC_16660)

Predicted SEED Role

"Lipoprotein YcfM, part of a salvage pathway of unknown substrate"

Protein Sequence (188 amino acids)

>LU632_RS14765 penicillin-binding protein activator LpoB (Erwinia tracheiphila SCR3)
MLLTLVLTGCISQQQGQQPAKTTESEPVQPVQNPVAPPAHPAQTLPQPPKMQSINWDASV
TPLVAQMLKAQGITPGSVLLVDGVKNSTNGSLQRSKATDALNNALQNNTEFTLVKPEQLA
AAKQTLGLSASDSLGSRSKAVGLARYLGAQYVLYTNVRGDVKSPTLQMQLMLVQTGELIW
SGDGAVQF