Protein Info for LU632_RS14620 in Erwinia tracheiphila SCR3

Annotation: metal ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01297: ZnuA
  • amino acids 34 to 297 (264 residues), 276.2 bits, E=1.4e-86

Best Hits

Swiss-Prot: 64% identical to HPF_HAEI3: Putative metal ABC transporter substrate-binding protein Hpf (hpf) from Haemophilus influenzae (strain NTHi 3655)

KEGG orthology group: K11604, manganese/iron transport system substrate-binding protein (inferred from 75% identity to pao:Pat9b_3264)

Predicted SEED Role

"Manganese ABC transporter, periplasmic-binding protein SitA" in subsystem Transport of Manganese

Protein Sequence (305 amino acids)

>LU632_RS14620 metal ABC transporter substrate-binding protein (Erwinia tracheiphila SCR3)
MKKWLSPVLFASGISCLILLLNISSALAQDKFKVITTFTIIADITRNVAGDKAIVESITK
PGAEIHQYQPTPGDIRRAQGAQLILSNGLNLELWFKKFYQHLPSVPEVEVSTGIVPMGIT
TGPYNGKPNPHAWMSPDNARIYVNNIRDALMKYDPENAAIYRKNAEIYQQKIADTLQPLR
DQIAKIPHDKRWLVTSEGAFSYLARDLGLTELYLWPINADQQGIPQQVRQVIDAMKKKAV
PTLFSESTVSDKPARQVARETGAHYGGVLYVDSLSSAEGPVPTYIDLLHVTTATVVKGIN
DGLKP