Protein Info for LU632_RS14475 in Erwinia tracheiphila SCR3

Annotation: phage regulatory protein/antirepressor Ant

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF09669: Phage_pRha" amino acids 24 to 105 (82 residues), 51.6 bits, see alignment E=1.1e-17 PF03374: ANT" amino acids 133 to 231 (99 residues), 82 bits, see alignment E=4.1e-27

Best Hits

KEGG orthology group: None (inferred from 54% identity to apl:APL_0499)

Predicted SEED Role

"FIG00510947: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>LU632_RS14475 phage regulatory protein/antirepressor Ant (Erwinia tracheiphila SCR3)
MVQQVNHNSTQTMVPAFAAGSVTMGSREIAALTEKRHFDVMRDIERMFEQLGEDVLGCAQ
NFVHPQNGQEYREYRLDREHAECLVTGYSAALRMRIIRRLRELEERSGAIPQTLPEALRL
AADMAEQNAQLAHKVQQDAPKVAFVNHYVESGGAKSLRETAKILNMPEKAMIDVLLRDKV
LFRQSGNLLPHALRQRDGLFTVKTGTSDFGHAYTQTRVTPRGVQWIAERYASELMGG