Protein Info for LU632_RS13760 in Erwinia tracheiphila SCR3

Name: yecC
Annotation: L-cystine ABC transporter ATP-binding protein YecC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00005: ABC_tran" amino acids 19 to 172 (154 residues), 133 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 79% identical to YECC_ECOLI: L-cystine transport system ATP-binding protein YecC (yecC) from Escherichia coli (strain K12)

KEGG orthology group: K10010, cystine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 82% identity to pao:Pat9b_2364)

MetaCyc: 79% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Cystine ABC transporter, ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>LU632_RS13760 L-cystine ABC transporter ATP-binding protein YecC (Erwinia tracheiphila SCR3)
MSAISVRNLIKQFAGHTVLHGIDLEVVRGEVVAIIGPSGSGKTTLLRSINLLETPDSGTI
QVGEIRIDATEASRQREQVRQLRQQVGFVFQNFNLFPHRTVLENIIEGPVIVGKESKAQA
IAHARQLLEKVGLQGLEARFPRRLSGGQQQRVAIARALAMRPRAILFDEPTSALDPELVA
EVLNTIRALADEKRTMVIVTHEMRFARDVADRAIFMDQGRIVEQGPAETLFSSPQHPRTR
QFLEG