Protein Info for LU632_RS13455 in Erwinia tracheiphila SCR3

Name: cmoA
Annotation: carboxy-S-adenosyl-L-methionine synthase CmoA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00740: tRNA (cmo5U34)-methyltransferase
  • amino acids 4 to 242 (239 residues), 413.1 bits, E=2e-128
• PF00891: Methyltransf_2
  • amino acids 54 to 166 (113 residues), 27.1 bits, E=7.7e-10
• PF13847: Methyltransf_31
  • amino acids 57 to 164 (108 residues), 33.8 bits, E=8.2e-12
• PF13649: Methyltransf_25
  • amino acids 60 to 158 (99 residues), 51.4 bits, E=4.5e-17
• PF08241: Methyltransf_11
  • amino acids 62 to 162 (101 residues), 40.5 bits, E=1.1e-13
• PF08242: Methyltransf_12
  • amino acids 62 to 160 (99 residues), 37.1 bits, E=1.3e-12

Best Hits

Swiss-Prot: 86% identical to CMOA_ERWT9: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 87% identity to ebi:EbC_25170)

MetaCyc: 84% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (246 amino acids)

>LU632_RS13455 carboxy-S-adenosyl-L-methionine synthase CmoA (Erwinia tracheiphila SCR3)
MSNRDTLFAAPIASLGDWTFDERVAEVFPDMIQRSVPGYSNIISMIGMLARRFVQPDSQV
YDLGCSLGAATLSVRRNIQASGCKIISVDNSPAMIERCRRHIDAFRAETPVEVVEADIRN
ITIENASLVVLNFTLQFLAPEERQALIARILSGLRPGGALVLSEKFSFADEKVGALLFDM
HHDFKRANGYSELEISQKRSMLENVMLTDSVETHKARLQTAGFKHVELWFQCFNFGSLIA
LKAGSV