Protein Info for LU632_RS13425 in Erwinia tracheiphila SCR3

Annotation: YebC/PmpR family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 237 (237 residues), 340.9 bits, see alignment E=2.3e-106 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 103 bits, see alignment E=9.7e-34 PF01709: Transcrip_reg" amino acids 82 to 236 (155 residues), 205.7 bits, see alignment E=3.5e-65

Best Hits

Swiss-Prot: 91% identical to Y1487_ERWT9: Probable transcriptional regulatory protein ETA_14870 (ETA_14870) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 91% identity to ddd:Dda3937_01618)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>LU632_RS13425 YebC/PmpR family DNA-binding transcriptional regulator (Erwinia tracheiphila SCR3)
MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDAASNPRLRAAMDKALSNN
MTRDTMNRAIARGVGGDDDSNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT
GGNLGTDGSVSYLFTRKGVVSFAPGLEEDTVMDAALEAGADDVVTYDDGAIDVFTPWESL
GDVKDELAAAGLTPESAEVTMIPSTKSDMDEDTAPKLLRLIDMLEDCDDVQEVYHNGEIS
DEVAATL