Protein Info for LU632_RS13190 in Erwinia tracheiphila SCR3

Annotation: cyclic diguanylate phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 245 to 263 (19 residues), see Phobius details PF12792: CSS-motif" amino acids 44 to 233 (190 residues), 68.8 bits, see alignment E=4.6e-23 PF00563: EAL" amino acids 273 to 501 (229 residues), 218.3 bits, see alignment E=1.1e-68

Best Hits

Swiss-Prot: 50% identical to PDED_ECOLI: Probable cyclic di-GMP phosphodiesterase PdeD (pdeD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 81% identity to ebi:EbC_24560)

Predicted SEED Role

"Rtn protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>LU632_RS13190 cyclic diguanylate phosphodiesterase (Erwinia tracheiphila SCR3)
MQVSQEVFGQYRRKRLLIALAVSALVLILTLSQRFFEEKSRIEKQSHTFAGNAIQRFDRL
FSPLEVAASNTLRLVGLPCDEVRFPLIEKLAMLQTVRSIILVDKDILYCSSIFGHGATTF
SSRYPELAVNNQRMMLSIDDHILKGSPILLLWTPQDTDNHAGILQVINIEMISNYLLEPT
LPWVERAIINVAGKSLEYGSQRLEQTVPSNNEISYQEASLRYPFSITLFGPAPARLALIT
LPSQLPLALLLSLLTGYIIWLATANRMSLAWQISYGISTREFMVYCQPLINSRSRECDGI
ELLLRWHNPRQGWVPPDVFIPLAEQHNLIAALTRFVLSEVVRQLPMLPTSPNFHIAINVA
SGHFHEREIIDDLQELWWPASPRPQLIVELTERDALPLVDQRVVSHLHKIGVKLAIDDFG
TGHSSLSYLKTLNPDVLKIDKVFTAAIGTDAINATVTDMVISLAQRLNISLVAEGVETAE
QAEYLRERGVDVLQGYFYARPMPLGDFPEWLNQYKTTPRQ