Protein Info for LU632_RS13140 in Erwinia tracheiphila SCR3

Annotation: Slp family lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00752: outer membrane lipoprotein, Slp family" amino acids 14 to 194 (181 residues), 203 bits, see alignment E=1.3e-64 PF03843: Slp" amino acids 19 to 168 (150 residues), 150.1 bits, see alignment E=1.6e-48

Best Hits

Swiss-Prot: 61% identical to YEAY_ECOL6: Uncharacterized lipoprotein YeaY (yeaY) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07285, outer membrane lipoprotein (inferred from 77% identity to ebi:EbC_24460)

Predicted SEED Role

"Starvation lipoprotein Slp paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>LU632_RS13140 Slp family lipoprotein (Erwinia tracheiphila SCR3)
MRKRMSLQFGSLVLLAVLLAGCASVPDSVRGTSPTPQQDLVRVMNAPQLYIGQESRFGGK
VVKVTNKNGVTRLEIAGMPLDDTARPVLGSPSTGRIYADIKGFADPVDFNGQMVTVVGII
TGTEKGQIGEASYNFVTIKVNGYQRWHLTQQIITPPQPVDPWIWYGPRPGHHHGGYWGPP
PGGFYTQVPAQVQTILTE