Protein Info for LU632_RS13065 in Erwinia tracheiphila SCR3

Name: dadX
Annotation: catabolic alanine racemase DadX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 4 to 354 (351 residues), 416.7 bits, E=3.9e-129
• PF01168: Ala_racemase_N
  • amino acids 9 to 217 (209 residues), 218 bits, E=1.3e-68
• PF00842: Ala_racemase_C
  • amino acids 232 to 352 (121 residues), 147.6 bits, E=1.5e-47

Best Hits

Swiss-Prot: 77% identical to ALR_ERWT9: Alanine racemase (alr) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 80% identity to ebi:EbC_24310)

MetaCyc: 71% identical to alanine racemase 2 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

"Alanine racemase, catabolic (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• L-alanine degradation I (2/2 steps found)
• alanine racemization (1/1 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)
• L-lysine degradation V (2/9 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (2/15 steps found)
• superpathway of L-lysine degradation (6/43 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Cysteine metabolism
• D-Alanine metabolism
• D-Arginine and D-ornithine metabolism
• D-Glutamine and D-glutamate metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Protein Sequence (356 amino acids)

>LU632_RS13065 catabolic alanine racemase DadX (Erwinia tracheiphila SCR3)
MSRPIVATIDTRALRHNLAVVRQTACHSRVWSVVKANAYGHGIERVWHSLADTDGFALLN
IEEAILLRECGWENPILLLEGFFHADELPVLDQYRLTTSVHSEWQIDALAKVKLSAPLNI
YLKMNSGMNRLGFQPEKVHTAWQRLRALQNVGEITLMAHFAEADKLTGVSQPMQRIKLAA
EGLACSRSFANSAATLWHPETHGDWVRPGIILYGASPSGCWQDISKIGVRPVMTLQSEII
AVQQLKAGDAVGYGSHYRADMEQRIGVVACGYADGYPRHASTGTPVWVDGVKTRTVGAIS
MDMITVDLTPCSQVQIGSRVELWGNNIKIDDVAQAAGTVGYELMCALAPRVPVQIC