Protein Info for LU632_RS12995 in Erwinia tracheiphila SCR3

Name: gapA
Annotation: glyceraldehyde-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 3 to 102 (100 residues), 143.6 bits, E=2.1e-46
• TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I
  • amino acids 4 to 324 (321 residues), 457.3 bits, E=1.5e-141
• PF02800: Gp_dh_C
  • amino acids 155 to 312 (158 residues), 235.9 bits, E=1.6e-74

Best Hits

Swiss-Prot: 88% identical to G3P_SHIBC: Glyceraldehyde-3-phosphate dehydrogenase (gapA) from Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 94% identity to yen:YE2265)

MetaCyc: 87% identical to glyceraldehyde-3-phosphate dehydrogenase A (Escherichia coli K-12 substr. MG1655)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• gluconeogenesis I (12/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• superpathway of N-acetylneuraminate degradation (18/22 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• Bifidobacterium shunt (12/15 steps found)
• heterolactic fermentation (14/18 steps found)
• superpathway of hexitol degradation (bacteria) (14/18 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• glycerol degradation to butanol (9/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12

Protein Sequence (331 amino acids)

>LU632_RS12995 glyceraldehyde-3-phosphate dehydrogenase (Erwinia tracheiphila SCR3)
MTIKVGINGFGRIGRIVFRAAQQRSDIEIVGINDLLDAEYMAYMLKYDSTHGRFEGTVEV
KNGHLVVNGKTIRVTSERDPANLKWNEIGVDVVAEATGIFLTDETARKHIEAGAKKVVLT
GPSKDDTPMFVMGVNHKTYAGQEIVSNASCTTNCLAPLAKVINDKFGIVEALMTTVHATT
ATQKTVDGPSHKDWRGGRGAAQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTARLAKPASYKEICEAIKSASEGELKGVLGYTEDEVVSTDFNGEKLTSVFDAKAGIA
LSDTFVKLVSWYDNETGYSNKVLDLIAHIAK