Protein Info for LU632_RS12940 in Erwinia tracheiphila SCR3

Name: purU
Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01842: ACT
  • amino acids 10 to 71 (62 residues), 32.2 bits, E=7.4e-12
• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 10 to 282 (273 residues), 424.6 bits, E=1.1e-131
• PF00551: Formyl_trans_N
  • amino acids 88 to 264 (177 residues), 186.9 bits, E=3e-59

Best Hits

Swiss-Prot: 90% identical to PURU_SHIFL: Formyltetrahydrofolate deformylase (purU) from Shigella flexneri

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 94% identity to ebi:EbC_24100)

MetaCyc: 90% identical to formyltetrahydrofolate deformylase (Escherichia coli K-12 substr. MG1655)
Formyltetrahydrofolate deformylase. [EC: 3.5.1.10]

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• folate transformations I (8/13 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• purine nucleobases degradation II (anaerobic) (11/24 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Protein Sequence (282 amino acids)

>LU632_RS12940 formyltetrahydrofolate deformylase (Erwinia tracheiphila SCR3)
MQAQTPQRKVLRTICPDAKGLIAKITNICYKHELNIVQNNEFVDHRTGRFFMRTELEGIF
NDTTLLADLDSALPDGSVRELNASGNRRIVILVTKEAHCLGDLLMKSAYGGLDVEIAAVI
GNHETLRSLVERFNIPFVLVSHEGSSREQHDNNMAVEIDRYQPDYVVLAKYMRVLTPGFV
QRYPNQIINIHHSFLPAFVGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVD
HTYSAEDMMRAGRDVEKNALSRALYEVLAQRVFVYGNRTIIL