Protein Info for LU632_RS12290 in Erwinia tracheiphila SCR3

Name: osmW
Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00528: BPD_transp_1
  • amino acids 15 to 185 (171 residues), 78.6 bits, E=2.6e-26

Best Hits

Swiss-Prot: 82% identical to OSMW_SALTY: Osmoprotectant import permease protein OsmW (osmW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 86% identity to pam:PANA_1972)

Predicted SEED Role

"Putative binding-protein-dependent transport system"

Protein Sequence (194 amino acids)

>LU632_RS12290 ABC transporter permease subunit (Erwinia tracheiphila SCR3)
MWLVSLAVGMPIVIGVPVGILIVRYKWLETPVLGLATIILTIPTIALFGMMIPLFSLIGQ
GIGVLPAVTVVFLYSLLPVVRNTHTALENLPDELREAGRGIGMTFWQRLRWVEIPMALPV
IFGGIRAAVVMDVGVMDIAAVIGAGGLGLLLLDGISGSDIRLLITGSVMICLMAIILDWL
LHRLQLAMTPKGIR