Protein Info for LU632_RS11675 in Erwinia tracheiphila SCR3

Name: rhaD
Annotation: rhamnulose-1-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 TIGR02624: rhamnulose-1-phosphate aldolase" amino acids 1 to 271 (271 residues), 429.3 bits, see alignment E=2.7e-133 PF00596: Aldolase_II" amino acids 12 to 237 (226 residues), 76.3 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 77% identical to RHAD_PECCP: Rhamnulose-1-phosphate aldolase (rhaD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01629, rhamnulose-1-phosphate aldolase [EC: 4.1.2.19] (inferred from 89% identity to ebi:EbC_20370)

MetaCyc: 68% identical to rhamnulose-1-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Rhamnulose-1-phosphate aldolase. [EC: 4.1.2.19]

Predicted SEED Role

"Rhamnulose-1-phosphate aldolase (EC 4.1.2.19)" in subsystem L-rhamnose utilization (EC 4.1.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>LU632_RS11675 rhamnulose-1-phosphate aldolase (Erwinia tracheiphila SCR3)
MQHILTSWFVQGMVKATSDMWLKGWDERNGGNVSLRLLDEEVQPFASDFYPEHRIVELTQ
PAPSLANCWFLVTGSGKFFRNVQLDPADSLVLLRVSQDGRAYRIYWGLSNGGLPTSELAS
HFQSHAVRMKVSNGADRVIMHCHATNFMSLSYVVDLDPARFTRLLWEGSTECLVVFPDGV
GIVPWMVPGTDGIGDATADSMASHSLVMWPFHGIFGAGPGLDETFGLIDTAEKSSEVVVK
VLSMGGMKQSITTEELIALGERFGVKPWQAALEARHPYVA