Protein Info for LU632_RS11670 in Erwinia tracheiphila SCR3

Name: rhaM
Annotation: L-rhamnose mutarotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 TIGR02625: L-rhamnose mutarotase" amino acids 3 to 103 (101 residues), 168.6 bits, see alignment E=1.8e-54 PF05336: rhaM" amino acids 3 to 103 (101 residues), 94.8 bits, see alignment E=1.7e-31

Best Hits

Swiss-Prot: 74% identical to RHAM_CROS8: L-rhamnose mutarotase (rhaM) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K03534, L-rhamnose mutarotase [EC: 5.1.3.-] (inferred from 86% identity to ebi:EbC_20380)

MetaCyc: 71% identical to L-rhamnose mutarotase (Escherichia coli K-12 substr. MG1655)
RXN0-5306 [EC: 5.1.3.32]

Predicted SEED Role

"L-rhamnose mutarotase" in subsystem L-rhamnose utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.- or 5.1.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>LU632_RS11670 L-rhamnose mutarotase (Erwinia tracheiphila SCR3)
MLRKAFVMQIHPDKHQEYQQRHNPIWPELACVLKEHGAHHYSIFLDAPRNLLFAVVEIES
ELRWNAIAHTEVCQKWWRSMCELMPSNPDFSPVSTELASVFYLA