Protein Info for LU632_RS10575 in Erwinia tracheiphila SCR3

Name: fliF
Annotation: flagellar M-ring protein FliF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 471 to 489 (19 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 1 to 571 (571 residues), 605.5 bits, see alignment E=6.1e-186 PF01514: YscJ_FliF" amino acids 49 to 223 (175 residues), 236.7 bits, see alignment E=1.6e-74 PF08345: YscJ_FliF_C" amino acids 255 to 447 (193 residues), 141 bits, see alignment E=4e-45

Best Hits

Swiss-Prot: 71% identical to FLIF_SALTY: Flagellar M-ring protein (fliF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 84% identity to ebi:EbC_26560)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>LU632_RS10575 flagellar M-ring protein FliF (Erwinia tracheiphila SCR3)
MNATVTQDQPEKKGLNDLFARLHANPRIPMIVAAAAAIAIVIAMVLWAKQPDYRVLYNNL
SNEDGGAIITQLTQMNIPYQFDDKSGALTVPADKVYELRLRLAQQGLPKGGAVGFELLDQ
EKFGISQFSEQVNYQRALEGELSRTIETLGPVKNVRVHLAMPKPTLFVREQKSPTASVTL
NLQPGRALDEGQVNAIVHMVSSSVAGLPPGNVTVVDQAGHLLTQSDNAGRDLNDAQLKYA
TDVENRYQQRIEAILNPIVGNGNVHAQVTAQIDFNNREQTDEKYQPNSDPASQTIRSRQT
NSSEQIGGQYPGGVPGALSNQPAPANSAPVTTAANSSQTNGNAANNTAANNNANQNNNSG
KSSVPSNTSNANTTNYEVDRTILHTKMNVGEVQRLSVAVVVNYKTDAAGKPIALTDAQIK
QIENLTREAMGFSDKRGDSLNVVNSPFNDAAETGGDLPFWQQQSFIDELMQAGRWLLVLI
VAWVLYRKLVRPQLRRKAEQEKAAAEALAVAQQNRGPEEDAVSVKLSKDELDQERKSQHR
MSAEVMSQRIREMSENDPRVVALVIRQWMKDEL