Protein Info for LU632_RS10535 in Erwinia tracheiphila SCR3

Name: fliN
Annotation: flagellar motor switch protein FliN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16973: FliN_N
  • amino acids 1 to 45 (45 residues), 64.8 bits, E=5.4e-22
• TIGR02480: flagellar motor switch protein FliN
  • amino acids 50 to 125 (76 residues), 113 bits, E=2.3e-37
• PF01052: FliMN_C
  • amino acids 53 to 123 (71 residues), 91.5 bits, E=2.6e-30

Best Hits

Swiss-Prot: 79% identical to FLIN_SALTY: Flagellar motor switch protein FliN (fliN) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02417, flagellar motor switch protein FliN/FliY (inferred from 91% identity to ebi:EbC_26640)

Predicted SEED Role

"Flagellar motor switch protein FliN" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Protein Sequence (134 amino acids)

>LU632_RS10535 flagellar motor switch protein FliN (Erwinia tracheiphila SCR3)
MSDTKKPSEDDISADDLWADALNEQATTSAPTEGVFKSLESNEIAGSLQDIDLIMDIPVK
LTVELGRTKMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRIT
DIITPSERMRRLSR