Protein Info for LU632_RS10440 in Erwinia tracheiphila SCR3

Name: flgK
Annotation: flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 3 to 375 (373 residues), 243.2 bits, see alignment E=3.5e-76 PF00460: Flg_bb_rod" amino acids 5 to 34 (30 residues), 25.6 bits, see alignment (E = 1.9e-09) PF22638: FlgK_D1" amino acids 92 to 328 (237 residues), 252.7 bits, see alignment E=7e-79 PF21158: flgK_1st_1" amino acids 337 to 419 (83 residues), 102.9 bits, see alignment E=1.5e-33 PF06429: Flg_bbr_C" amino acids 508 to 546 (39 residues), 30.1 bits, see alignment 5.6e-11

Best Hits

Swiss-Prot: 62% identical to FLGK_ECOLI: Flagellar hook-associated protein 1 (flgK) from Escherichia coli (strain K12)

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 82% identity to ebi:EbC_16450)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>LU632_RS10440 flagellar hook-associated protein FlgK (Erwinia tracheiphila SCR3)
MSNLINTALSGINAASAALNTTSNNISNYSVAGYSRQTTILAQSNSTLTGTNYIGNGVSV
SSVNREYDVFITNQLRAASTSSSALSTQYSQLSNIDNMFSSTTNTLSTNMQGFFSSLQTL
VSNADDSSARQAVLGKADGLVNQFQVTDTYLKNLDSSLNTSVSSMVDQINGYAKQIANVN
QQITKLTGAGAGTAPNDLLDQRDQLVSKLNDLVGVTVSQQDGGSYSISIGNGISLVQGDS
YNQLAAVASSADPGRTTIATVDASTGAKTEIPEKLVATGSLGGLLAFRTDLDNTRNQLGQ
LALGLASSFNTQHEAGYDSNGDMGGAFFNYGSPSVTTNTSNKGTASMTAMVADASAVEAS
NYKVSYDGTNWNVTRLSDNASVTTTSSTDSSGNSTLSFDGLQLTLGGTAQAKDSFLVKPV
SNVISSMSVNITDEAKLAAAGSDGGVSDNINAQSLLDLQTKKVIGGDSTLTQAYASMVAN
IGNKTSTLETTSTTQTNVVTQLTNQQQSVSGVNLDEEYGNLTRYQQYYTANAQVIQTASA
IFNALITAVS