Protein Info for LU632_RS10365 in Erwinia tracheiphila SCR3

Name: murJ
Annotation: murein biosynthesis integral membrane protein MurJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 83 to 110 (28 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 237 to 262 (26 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 441 to 466 (26 residues), see Phobius details amino acids 478 to 500 (23 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 2 to 502 (501 residues), 544.3 bits, see alignment E=1.5e-167 PF03023: MurJ" amino acids 28 to 478 (451 residues), 503 bits, see alignment E=6.9e-155 PF14667: Polysacc_synt_C" amino acids 353 to 500 (148 residues), 39.4 bits, see alignment E=6.7e-14

Best Hits

Swiss-Prot: 84% identical to MURJ_SALTY: Probable lipid II flippase MurJ (murJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03980, virulence factor (inferred from 88% identity to pao:Pat9b_1459)

MetaCyc: 84% identical to lipid II flippase MurJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-286

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>LU632_RS10365 murein biosynthesis integral membrane protein MurJ (Erwinia tracheiphila SCR3)
MNLLKSLAAVSSMTLFSRVLGFARDAIVARVFGAGMATDAFFVAFKLPNLLRRIFAEGAF
SQAFVPILAEYKSKQGEEATRVFVSYVSGLLTLVLAVITLAGIVVAPWVIMLTAPGFSDT
ADKFALTSSLLRVTFPYILLISLASLTGAILNTWNRFSVPAFAPTLLNISMIGFALFAAP
YFHPSVMALAWAVVVGGGLQLFYQLPHLKRIGMLVLPRINLKDAGVWRVMRQMGPAILGV
SVSQISLIINTIFASFLVSGSVSWMYYADRLMEFPSGVLGVALGTILLPALAKSFASGNH
AEYNRLMDWGLRLSFLLALPSAVALGILSKPLVVSLFQYGKFTAFHAAMTQRALVAYSVG
LVGLIVVKILAPGFYSRQDIKTPVRIAIFTLLMTQLMNLVFIGPLKHAGLSLSIGLAACL
NALMLFWQLRKQNIFQPQPGWFSFLLRLGLAVAVMAAALLGLLWFMPDWAQGSMLWRLMR
LAVVCAVGGAVYFAVLALLGFRVRDFSRTTVE