Protein Info for LU632_RS10300 in Erwinia tracheiphila SCR3

Annotation: rhodanese-related sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17773: UPF0176_N
  • amino acids 25 to 117 (93 residues), 72 bits, E=6.6e-24
• PF00581: Rhodanese
  • amino acids 138 to 232 (95 residues), 55.7 bits, E=9e-19
• PF12368: Rhodanese_C
  • amino acids 245 to 307 (63 residues), 80.6 bits, E=1.3e-26

Best Hits

Swiss-Prot: 87% identical to Y2059_ERWT9: UPF0176 protein ETA_20590 (ETA_20590) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K07146, UPF0176 protein (inferred from 86% identity to ebi:EbC_16180)

MetaCyc: 80% identical to tRNA U34 hydroxylase TrhO (Escherichia coli K-12 substr. MG1655)
RXN0-7349

Predicted SEED Role

"Rhodanese domain protein, Enterobacterial subgroup, YceA homolog"

Protein Sequence (350 amino acids)

>LU632_RS10300 rhodanese-related sulfurtransferase (Erwinia tracheiphila SCR3)
MPVLHNLVSNEELKARMLAETEPRTTVSFYKYFTIDDPKAFRDALYVQFTQLKVFGRVYV
ATEGINAQISVPASHYEALKTMLYGFDPALNNLRMNIALDDDGKSFWVLRLKVRERIVAD
GIADETFDASNVGGYLKASEVNVLLDDPDVVFVDMRNHYEYEVGRFENALEIPADTFRDQ
LPMAVDMLQDNKDKKIVMYCTGGIRCEKASAWMRHNGFENVYHIEGGIIEYARRAREQGL
PVRFKGKNFVFDERMGERISEDVIAQCHQCGAPCDTHVNCKNDGCHLLFIQCPECAEKYH
HCCSPVCMEELALSPEEQRARRAGRENGNKIFNKSRGLLNITLRIPSADS