Protein Info for LU632_RS10100 in Erwinia tracheiphila SCR3

Annotation: TusE/DsrC/DsvC family sulfur relay protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family" amino acids 2 to 108 (107 residues), 162 bits, see alignment E=2.5e-52 PF04358: DsrC" amino acids 3 to 108 (106 residues), 147.5 bits, see alignment E=9.2e-48

Best Hits

Swiss-Prot: 75% identical to TUSE_PHOLL: Sulfurtransferase TusE (tusE) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 83% identity to eta:ETA_20910)

MetaCyc: 70% identical to sulfur transfer protein TusE (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)" in subsystem Sulfate reduction-associated complexes (EC 2.8.1.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>LU632_RS10100 TusE/DsrC/DsvC family sulfur relay protein (Erwinia tracheiphila SCR3)
MYFNGKEIQCDAQGYLKSVNDWSEAIALALAEEEEIVMSEAHWEVVFFVREFYLEFNTSP
AVRMLVQAIAKKYGEEKGNSRYLFRLFPKGPAKQATKIAGLPKPAKCL