Protein Info for LU632_RS09485 in Erwinia tracheiphila SCR3

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details PF00529: CusB_dom_1" amino acids 51 to 366 (316 residues), 35.8 bits, see alignment E=1.6e-12 PF13533: Biotin_lipoyl_2" amino acids 69 to 116 (48 residues), 57.8 bits, see alignment 1.8e-19 PF16576: HlyD_D23" amino acids 179 to 314 (136 residues), 55.9 bits, see alignment E=9.6e-19 PF13437: HlyD_3" amino acids 241 to 326 (86 residues), 48.1 bits, see alignment E=4.3e-16

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 81% identity to ebi:EbC_14380)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>LU632_RS09485 HlyD family secretion protein (Erwinia tracheiphila SCR3)
MHNQSTSHPDDKQQQQDNVEQPERQRPGKKPLVILAIVVVIVLIIALWFWLSTRNIESTD
DAFTDADAVTIAPKASGYVTQLLVRDNQRVKKGDLLVVIDPRDAMAQRDQAEAQLALAVS
QWHQAEAQLSLSEVQYPAQKDQALAQQAKAEANFLNAQEDYKRQRGVDPRATSQRSIDAA
SAQLRSAKAELESAKAQVEVASQIALQIRQQKTNVEARQAQVQQAQAQLNIANLNLSWME
VRAPYDGFVTRRNVQMGTLVQAGTSLFSLVSADTWITANFKESQLSRMKPGNKVEITIDA
WPDRKLHGHVDSIQMGSGSRFSTFPAENATGNYVKIVQRVPVKIVIDEGLDPNRPLPLGL
SAEPEVAVE