Protein Info for LU632_RS09360 in Erwinia tracheiphila SCR3

Annotation: cyclopropane-fatty-acyl-phospholipid synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF02353: CMAS" amino acids 134 to 402 (269 residues), 273.4 bits, see alignment E=5e-85 PF13489: Methyltransf_23" amino acids 178 to 300 (123 residues), 29.5 bits, see alignment E=1.5e-10 PF08242: Methyltransf_12" amino acids 197 to 292 (96 residues), 34.1 bits, see alignment E=9.7e-12 PF08241: Methyltransf_11" amino acids 197 to 293 (97 residues), 35.6 bits, see alignment E=3.1e-12 PF13649: Methyltransf_25" amino acids 197 to 290 (94 residues), 44.1 bits, see alignment E=6.9e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 70% identity to ebi:EbC_13900)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>LU632_RS09360 cyclopropane-fatty-acyl-phospholipid synthase family protein (Erwinia tracheiphila SCR3)
MYQPELTYSPRPRSGKRLSTSRRIVFALLKQIEGAGLHLHDPHLGSRFFGNPQAELQAEI
RVNHSRTYRRILLGGSIAAAETYMDGEWNTPDLTAVIQTLAINDSVLNKLGSRFSRVAAL
LNKCRHLLHRNSVSQAKKNIAAHYDLGNDFYRSFLDESMLYSSGWYALPEMSLAEAQQAK
MRRLCGRLQLTSHDHLLEIGTGWGAMAEFAAREYGCRVTTTTISQEQYDYSCRRIAAAGL
ADRVTVLKQDYRQLNGQYDKLVSVEMIEAVGQQYIPLFFARCRDLLKPDGRLALQAITIS
EARFARYARSVDFIQRYIFPGGFLPAVSMLEANLTASRFTLHNLFEIGPDYARTLRAWRL
RYEAAMPQLQNAHFDSHFHRMWRFYLCYCEAGFLAGTIGTVQLTAQKNENA