Protein Info for LU632_RS09305 in Erwinia tracheiphila SCR3

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 265 to 281 (17 residues), see Phobius details PF00892: EamA" amino acids 10 to 136 (127 residues), 59.1 bits, see alignment E=2.7e-20 amino acids 146 to 280 (135 residues), 60.8 bits, see alignment E=8e-21

Best Hits

Swiss-Prot: 45% identical to PECM_DICD3: Protein PecM (pecM) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 59% identity to xbo:XBJ1_2340)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>LU632_RS09305 EamA family transporter (Erwinia tracheiphila SCR3)
MNKLSTLSDILITALAPVIWGSTYIVTTQTLPPHMPLLASVIRALGAGCILLLICRIRPH
GIWWLRIAILGFLNIGLFFYCLFAAAYFLPGGLASLVMSCQPIIVMVVGAIIFRYKLRPV
HLLSAAIGVTGIGLLVLNSAVALNFKGVAIGLIGTFSMAMGILLNKHWGRPENMSLLAFT
GWQLAMGGLMLLPAALTLEKLPETLTFTNMLGYGWLTLAGGVLGYVVWFRGIEKLPPVTT
SFLGFISSLSACVLGYIILGQTFTQLQLLGCVAIVSSIYLARPQHR