Protein Info for LU632_RS09285 in Erwinia tracheiphila SCR3

Annotation: pseudouridine-5'-phosphate glycosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 97 to 116 (20 residues), see Phobius details PF04227: Indigoidine_A" amino acids 13 to 301 (289 residues), 369.2 bits, see alignment E=8e-115

Best Hits

Swiss-Prot: 68% identical to PSUG_SERP5: Pseudouridine-5'-phosphate glycosidase (psuG) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 68% identity to spe:Spro_1699)

MetaCyc: 44% identical to pseudouridine-5'-phosphate glycosidase (Escherichia coli K-12 substr. MG1655)
Pseudouridylate synthase. [EC: 4.2.1.70]

Predicted SEED Role

"Indigoidine synthase A-like protein, uncharacterized enzyme involved in pigment biosynthesis"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>LU632_RS09285 pseudouridine-5'-phosphate glycosidase (Erwinia tracheiphila SCR3)
MLNKEFKLDYLPEVKEALAQGRPVVALESNVITHGLNYPDNLATALQVEDAVRASGCVPS
TTGIDNGRVLVGMNYQQLERFATTAGIAKVSSRDLPFILATGAMGATSVASSLVIAELAG
IPFFSSAGLGGVHRGAETSMDISADLIQVTRSKVTVICAGVKNILDVGLTLEYLETQCVP
VVSWQCDDFPAFYCRSSGFKSPMRIDCSEQIARAIEINRHLPGAAGLVIATPTREEDAIN
SEEVQQAIEEAISQAKNNGITGNGVTKFIMKAVEKMTAGRSAEANKAVLINTARIAGEIA
MAHYLYRQKHQ