Protein Info for LU632_RS08810 in Erwinia tracheiphila SCR3

Name: wcaK
Annotation: colanic acid biosynthesis pyruvyl transferase WcaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF04230: PS_pyruv_trans" amino acids 13 to 349 (337 residues), 118.4 bits, see alignment E=2.9e-38

Best Hits

Swiss-Prot: 72% identical to AMSJ_ERWAM: Amylovoran biosynthesis protein AmsJ (amsJ) from Erwinia amylovora

KEGG orthology group: None (inferred from 78% identity to ebi:EbC_29330)

Predicted SEED Role

"Colanic acid biosysnthesis protein WcaK" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>LU632_RS08810 colanic acid biosynthesis pyruvyl transferase WcaK (Erwinia tracheiphila SCR3)
MKILLVGNHTCGNRGDGAILRGLIDSLMHAQSDLQIEVISRYPVISSYLLGQSVIPDDLF
LALKKGKNGLADKIKRRLMPKIMMSHISGKGWHKMLPVPKYLQDFSEKLRQYDLIIQVGG
SFFVDLYGPLQFEHSLCALLAKKPIYMIGHSVGPFQKESFNEIANFVFSRVQSLVLRESV
SLEMMKQGGITTEKVVAGSDTAFLVRARHVSQPSHTLQHWQNIISANKTIIITVRKLAPF
DKRLGVTQHEYERAFARVINAMIDKGYQVVALSTCTGIDSYGNDDHMIAPNLQEHVNQKE
KYHVVMDELNDLELGVLLSECYLTIGTRLHSAIISMTFGTPAVAINYEHKSLGVMNQLGL
PDMAMDVKSLMDGTIIKKVNTILDDYAAVKQQVSRAVSEEQQRGDQLIADVLKTG