Protein Info for LU632_RS08675 in Erwinia tracheiphila SCR3

Name: baeS
Annotation: two-component system sensor histidine kinase BaeS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details PF00672: HAMP" amino acids 183 to 234 (52 residues), 47.2 bits, see alignment 3.4e-16 PF00512: HisKA" amino acids 239 to 301 (63 residues), 48.2 bits, see alignment E=1.3e-16 PF02518: HATPase_c" amino acids 348 to 457 (110 residues), 95.4 bits, see alignment E=4.4e-31

Best Hits

Swiss-Prot: 64% identical to BAES_ECOLI: Signal transduction histidine-protein kinase BaeS (baeS) from Escherichia coli (strain K12)

KEGG orthology group: K07642, two-component system, OmpR family, sensor histidine kinase BaeS [EC: 2.7.13.3] (inferred from 82% identity to ebi:EbC_29570)

MetaCyc: 64% identical to sensor histidine kinase BaeS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensory histidine kinase BaeS"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>LU632_RS08675 two-component system sensor histidine kinase BaeS (Erwinia tracheiphila SCR3)
MFARLRIGITAKLFIAIFSTCMLVLATMHWGVRLSFEHGFIDYIKKGNEQRLNLLAGALA
DQYEQHGNWDFLRSNNQLAFQILHSIEQNPDASTLLPPHGWSTQFWVIDQQYHVMIGPRN
PLPPEGHRRNISTRDGHIVGWVIGSPPERLTRSADINFDQQQKRTSWIIVGLTMLLAALV
TWLMSRGFLAPVRRLVEGTHQLAAGDFTSRVTANCSDELGRLAQDFNRLASTLEKNESMR
RAFMADISHELRTPLAILHGELEALQDGVRKLTPESIASLQGEVSTLTKLVEDVHQLSLS
DKGALAYRKSDINLVPLLELVAGNFRHRYKQHNLSLTLDLPERAVLFGDATRMMQLFTNL
TENSLRYTDAGGGLTISLANEGNQLVIRFDDSSPGITDEQRGQIFERFYRAEGSRNRASG
GSGLGLSICQNIVEAHDGSISAESAPAGGMRITVHLPGLQH