Protein Info for LU632_RS08665 in Erwinia tracheiphila SCR3

Name: yegQ
Annotation: tRNA 5-hydroxyuridine modification protein YegQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01136: Peptidase_U32
  • amino acids 77 to 343 (267 residues), 283.1 bits, E=1.5e-88
• PF16325: Peptidase_U32_C
  • amino acids 359 to 432 (74 residues), 65.4 bits, E=4.2e-22

Best Hits

Swiss-Prot: 81% identical to YEGQ_ECOLI: Uncharacterized protease YegQ (yegQ) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 84% identity to ebi:EbC_29590)

Predicted SEED Role

"Putative protease"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (458 amino acids)

>LU632_RS08665 tRNA 5-hydroxyuridine modification protein YegQ (Erwinia tracheiphila SCR3)
MFKPELLSPAGTLKNMRYAFAYGADAVYAGQPRYSLRARNNEFNHENLATGINEAHALGK
KFYVVVNIAPHNAKLKTFIRDLQPVVAMGPDALIMSDPGLIMMVRDTFPQTDIHLSVQAN
AVNWATVKFWQKMGLTRAILSRELSLEEIEEIRQQVPDMELEIFVHGALCMAYSGRCLLS
GYINKRDPNQGTCTNACRWEYKVLEGKQDELGQIVHQHQSIPVKTVEPTLGQGQPTDSMF
LIEETMRPGEYMIAFEDEHGTYIMNSKDLRAVAHVGRLSAMGIHSLKIEGRTKSHYYCAR
TAQVYRRAIDDAALGKPFDNALLETLEGLAHRGYTEGFLRRHTHDSYQNYQQSFSASDRQ
QFVGELTGERRGTLAQVAVKNRFSVGDSLELMTPAGNITFPLQHMENARALPVSVAPGNG
HLVWVPLPEEIDLAFALLIRNFPAAMPDRPDSPASAPL