Protein Info for LU632_RS08565 in Erwinia tracheiphila SCR3

Annotation: CidA/LrgA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03788: LrgA
  • amino acids 23 to 114 (92 residues), 98 bits, E=1.3e-32

Best Hits

Swiss-Prot: 62% identical to Y2790_YERE8: UPF0299 membrane protein YE2790 (YE2790) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K06518, holin-like protein (inferred from 72% identity to ebi:EbC_29750)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Protein Sequence (131 amino acids)

>LU632_RS08565 CidA/LrgA family protein (Erwinia tracheiphila SCR3)
MRSTLYAGGRYLRAFLIIYLSLWAGNGIASLLPVMIPGSIIGILLLFALLASQLLPVRWV
QPGSRLLIRYMALLFVPISVGVMEHTDILRAQFGPIVVSVALSTFIVLITVGLASHKLHG
RATLKPGASDE