Protein Info for LU632_RS08555 in Erwinia tracheiphila SCR3

Name: cdd
Annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00383: dCMP_cyt_deam_1" amino acids 59 to 140 (82 residues), 55.7 bits, see alignment E=3.9e-19 PF08211: dCMP_cyt_deam_2" amino acids 157 to 276 (120 residues), 153 bits, see alignment E=5e-49

Best Hits

Swiss-Prot: 66% identical to CDD_ERWT9: Cytidine deaminase (cdd) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 72% identity to ebi:EbC_29770)

MetaCyc: 66% identical to cytidine/deoxycytidine deaminase (Escherichia coli K-12 substr. MG1655)
Cytidine deaminase. [EC: 3.5.4.5]; 3.5.4.5 [EC: 3.5.4.5]

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>LU632_RS08555 cytidine deaminase (Erwinia tracheiphila SCR3)
MQSRFQTALASLPPLLQTAVFPFLNANDFPGYFTSGQVSAILSESGLDHRELTFALLPLA
AACAVTPLSGFNVGAVALGESGHLWFGANMEFPGATMQQTVHAEQSAVTHAWMRGETRLV
AMTINYTPCGHCRQFMNELNSATTLSIHLPGRPPALLVDYLPDTFGPRDLSIHTLLLDPV
DHGLVIKGNPLHRAALDAANRSYAPYSQALSGVALQTADGTIFSGSYAENAAFNPSLPPL
QTALILLNMSGYDMQDIQRAMLAEEADAKLIQRHATEATLQALGCRDITLIPLR