Protein Info for LU632_RS08550 in Erwinia tracheiphila SCR3

Annotation: NAD-dependent malic enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00390: malic
  • amino acids 81 to 261 (181 residues), 273 bits, E=1.2e-85
• PF03949: Malic_M
  • amino acids 271 to 530 (260 residues), 349.3 bits, E=1.3e-108

Best Hits

Swiss-Prot: 90% identical to MAO1_ERWT9: NAD-dependent malic enzyme (maeA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00027, malate dehydrogenase (oxaloacetate-decarboxylating) [EC: 1.1.1.38] (inferred from 92% identity to ebi:EbC_29780)

MetaCyc: 78% identical to malate dehydrogenase (oxaloacetate-decarboxylating) (Escherichia coli K-12 substr. MG1655)
Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 1.1.1.38]

Predicted SEED Role

"NAD-dependent malic enzyme (EC 1.1.1.38)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 1.1.1.38)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• gluconeogenesis I (12/13 steps found)
• mixed acid fermentation (14/16 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• L-malate degradation II (1/1 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• glyoxylate cycle (4/6 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• chitin deacetylation (2/4 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• L-carnitine degradation II (1/3 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (8/14 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• methylgallate degradation (2/6 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• reductive TCA cycle II (6/12 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• methylaspartate cycle (9/19 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• syringate degradation (3/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.38

Protein Sequence (565 amino acids)

>LU632_RS08550 NAD-dependent malic enzyme (Erwinia tracheiphila SCR3)
MELEHESKRPLYIPYAGPILLEFPLLNKGNAFSVEERNEFNLRGLLPETVETIEEQAQRA
WRQFQDFKNDNDKHVYLRNIQDTNETLFYRLLDNHLEEMMPIIYTPTVGAACEHFSEIYR
RARGVFISYPNRENIEDMLQNATKQNVKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYT
ACGGISPAYTLPIVLDVGTNNQQLLNDPLYMGWRHPRITGEEYDQFVDEFIQAVKSRWPN
VLLQFEDFAQKNAMPLLERYRNEVCCFNDDIQGTASVTLGTLIAASRAAGGKLSEQKVVF
LGAGSAGCGIAEQIVAEMKSEGLSDDEARARVFMVDRFGLLTDKLPNLISFQSKLVQKSD
NLSDWDSSSDSLSLLDVVRNARPDILIGVSGQTGLFSEEIIREMHKHCPRPIVMPLSNPT
SRVEATPQDILTWTNGEALVATGSPFTPVTLKEKTYPIAQCNNSYIFPGVGLGVIASGAT
RVTDSMLMAASRALAECSPLVNDGKGPVLPEVKDIQGVSKVIAMAVGKAAQEAGVAVATT
EDVLSRAISANFWLPQYRHYRRTSI