Protein Info for LU632_RS08510 in Erwinia tracheiphila SCR3

Annotation: DUF418 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 48 to 76 (29 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 122 (16 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details PF04235: DUF418" amino acids 215 to 373 (159 residues), 146 bits, see alignment E=5.4e-47

Best Hits

Swiss-Prot: 60% identical to YEIB_ECOLI: Uncharacterized protein YeiB (yeiB) from Escherichia coli (strain K12)

KEGG orthology group: K07148, uncharacterized protein (inferred from 67% identity to ebi:EbC_29860)

Predicted SEED Role

"FIG00924762: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>LU632_RS08510 DUF418 family protein (Erwinia tracheiphila SCR3)
MPRIQALDLIRGVSILGILLLNIVAFGQPRAAYLNPAWHGQPAWADALSWAVMDFFALLK
FLSLFALLFGAGIQMLLPAGKRWLQARLSWLVLLGSMHGVFLWDGDILLDYGLIGLLAWR
MIRDAGSSRRLLNTGVLLYLVGCGALLAMSMASGEQVNDSWLPGFAEVQYETFWKVHGGW
EAVRNRLDMLMSGLLSLAAQYGWQLAGLMLIGAALMRSGWLNGERSQAHYRRCALMLIGT
AWLIQIPAIYLQWHSGWDFRWSGFFLQLPSELAAPLQALGYAALCFGWWPTLCQLKITTA
VTCVGRMALSNYLLQTLICTTLFNRLGWFNQLDRVHLLMLVPLVWLCNILFSVYWLRYFR
LGPMEWLWRKLTRLAGGKPLHKRA