Protein Info for LU632_RS08160 in Erwinia tracheiphila SCR3

Name: ubiG
Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 16 to 234 (219 residues), 288.9 bits, E=1.1e-90
• PF01209: Ubie_methyltran
  • amino acids 48 to 158 (111 residues), 35.6 bits, E=3.7e-12
• PF05175: MTS
  • amino acids 56 to 127 (72 residues), 23.5 bits, E=2.1e-08
• PF13847: Methyltransf_31
  • amino acids 57 to 172 (116 residues), 59.8 bits, E=1.5e-19
• PF06325: PrmA
  • amino acids 57 to 162 (106 residues), 26.8 bits, E=2e-09
• PF07021: MetW
  • amino acids 57 to 150 (94 residues), 22.4 bits, E=4.6e-08
• PF02353: CMAS
  • amino acids 57 to 169 (113 residues), 37.6 bits, E=8.7e-13
• PF13489: Methyltransf_23
  • amino acids 57 to 165 (109 residues), 86.7 bits, E=8.3e-28
• PF05401: NodS
  • amino acids 59 to 181 (123 residues), 24.1 bits, E=1.7e-08
• PF13649: Methyltransf_25
  • amino acids 60 to 153 (94 residues), 68.6 bits, E=3.6e-22
• PF08241: Methyltransf_11
  • amino acids 61 to 157 (97 residues), 74.3 bits, E=5.5e-24
• PF08242: Methyltransf_12
  • amino acids 61 to 154 (94 residues), 59 bits, E=3.7e-19

Best Hits

Swiss-Prot: 83% identical to UBIG_ERWT9: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 87% identity to ebi:EbC_30410)

MetaCyc: 77% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (50/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Protein Sequence (242 amino acids)

>LU632_RS08160 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Erwinia tracheiphila SCR3)
MKAEQNGQTANVDHSEIAKFEAAASRWWDLEGEFKPLHRINPLRLGYIAERSHGLFGKKV
LDVGCGGGILAESMAREGAEVSGLDMGTEPLHIAHLHALESGLKIDYVQQTVEDHATQFA
GQYDVVTCMEMLEHVPDPRSVVHACARLVKPGGEVFFSTINRNSKAWLLAIIGAEYVLRM
LPRGTHDIKKFIRPGELIGWTDETPLRESDIIGLHYNPLTNKFRLAPGVDVNYMLHTHHA
AG