Protein Info for LU632_RS08130 in Erwinia tracheiphila SCR3

Annotation: nicotinamide mononucleotide deamidase-related protein YfaY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 1 to 399 (399 residues), 416.8 bits, see alignment E=8e-129 TIGR00177: molybdenum cofactor synthesis domain" amino acids 2 to 166 (165 residues), 102.3 bits, see alignment E=2.3e-33 PF00994: MoCF_biosynth" amino acids 6 to 170 (165 residues), 109 bits, see alignment E=8.3e-36

Best Hits

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 76% identity to ebi:EbC_30460)

Predicted SEED Role

"Molybdopterin binding motif, CinA N-terminal domain / C-terminal domain of CinA type E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>LU632_RS08130 nicotinamide mononucleotide deamidase-related protein YfaY (Erwinia tracheiphila SCR3)
MIRVEMLATGDEVLHGQIVDSNSAWLAELLLQHGLPMTRRQTVGDSLDELVGVLKERSEV
ADVLIVNGGLGPTSDDLSALAAAKAAGVPLVLNEYWLTQMAAFFAGRGRKMAASNRKQAE
LPDGAEMLDNPIGTACGFAIELNRCWIFFTPGVPSEYKMMVEQQILPRLQARFTLPAPPV
CLRMTTFGRGESELASAIEPLPLPEGVVMGYRASMPIIELKLNGPVSRLPEMERVWQQVR
EIAGESVIFEGREGLPAQIARCLTEKGHSLAVSEQFTAGLLQWQLASADAPLKAGNMLPT
REENLSALIERAQQLAGADNASLALVVGGIQNETVGFALFTPDGCWGQRVKISLSRYDLK
TRQDVVAMIALNMLRCWLNGLDLTVVGQGWIEVVESLSQPC