Protein Info for LU632_RS08125 in Erwinia tracheiphila SCR3

Name: menE
Annotation: o-succinylbenzoate--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 10 to 318 (309 residues), 154.4 bits, E=4.1e-49
• TIGR01923: O-succinylbenzoate-CoA ligase
  • amino acids 30 to 445 (416 residues), 343.2 bits, E=1.2e-106
• PF13193: AMP-binding_C
  • amino acids 367 to 425 (59 residues), 28.3 bits, E=2.8e-10

Best Hits

Swiss-Prot: 53% identical to MENE_SALTY: 2-succinylbenzoate--CoA ligase (menE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01911, O-succinylbenzoic acid--CoA ligase [EC: 6.2.1.26] (inferred from 55% identity to etr:ETAE_2354)

MetaCyc: 52% identical to o-succinylbenzoate--CoA ligase (Escherichia coli K-12 substr. MG1655)
o-succinylbenzoate--CoA ligase. [EC: 6.2.1.26]

Predicted SEED Role

"O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 6.2.1.26)

MetaCyc Pathways

• superpathway of chorismate metabolism (50/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (8/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.26

Protein Sequence (456 amino acids)

>LU632_RS08125 o-succinylbenzoate--CoA ligase (Erwinia tracheiphila SCR3)
MVALNDWPWRDHARRHPDRSAMIAGNRQLSWFALAQQVDALAAGFLCQGVYTGCGVIMKA
VNSQQAALAYLALLQCGVRLLPLNPRIPQAQIDVLLPGLNIDFALILSGTPLPGVAALFL
HSQQKAVSCPWQPQALATMTLTSGSSGVAKAAVHTFQAHLASAAGVVEKLCFSAEDSWLL
SLPLYHVSGQGIIWRWLRAGARLVLAEATPLPQALEQSTFASLVPTQLLRLLQQPRRPQH
LRTLLLGGATIPVGLACGAEALGIACWCGYGMTETASTITAKRADESGSVGLPLAGHRIR
VVDGEVQIQSDALASGYWQQGQLLPLVNDKGWFATRDGGYFNADGLQLTGRLDNQFFSGG
EGIQPEQIEAVLQTHPAVEQVFIVPEWDLEFGHRPVALVRLKHAVPLAALADWAASHLAG
FQRPVSWYPLPEPDGGGIKISRQWLRTWLANRQRME