Protein Info for LU632_RS08110 in Erwinia tracheiphila SCR3

Name: menH
Annotation: 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 13 to 127 (115 residues), 29.3 bits, E=1.4e-10
• TIGR03695: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  • amino acids 15 to 249 (235 residues), 235.9 bits, E=2.4e-74
• PF00561: Abhydrolase_1
  • amino acids 16 to 124 (109 residues), 62.6 bits, E=1.1e-20
• PF05057: DUF676
  • amino acids 17 to 95 (79 residues), 21.3 bits, E=4.2e-08
• PF00975: Thioesterase
  • amino acids 18 to 106 (89 residues), 37.5 bits, E=7.5e-13
• PF12697: Abhydrolase_6
  • amino acids 18 to 245 (228 residues), 61.4 bits, E=5.2e-20

Best Hits

Swiss-Prot: 50% identical to MENH_SERP5: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menH) from Serratia proteamaculans (strain 568)

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 56% identity to ebi:EbC_30510)

MetaCyc: 45% identical to 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. [EC: 4.2.99.20]

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

• superpathway of chorismate metabolism (50/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (8/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Protein Sequence (254 amino acids)

>LU632_RS08110 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase (Erwinia tracheiphila SCR3)
MILHACWRGSHHNPRPVLVWLHGFLGSGEDWRSVQADFDGWPQLSIDLPGHSGSGDQRAG
DFDTLCTQLKATLAHHQVQRYWLIGYSLGGRLALYYACRHAQAGLQGVVVEGAHYGLASA
TAREQRLVHDRRWAAKFHHQPLKLTLEEWYQQSVFADLTVRQRDTLVSLRACHHPDALAC
ALLAMSLARQPFLLPELHRLPRLHFLCGERDHKFRQLTEQASLPLTVVPDAGHNAHRANP
SAFAAILAHQIINV