Protein Info for LU632_RS08110 in Erwinia tracheiphila SCR3

Name: menH
Annotation: 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF12146: Hydrolase_4" amino acids 13 to 121 (109 residues), 29.7 bits, see alignment E=1e-10 TIGR03695: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase" amino acids 15 to 249 (235 residues), 235.9 bits, see alignment E=2.4e-74 PF00561: Abhydrolase_1" amino acids 16 to 124 (109 residues), 62.6 bits, see alignment E=1.1e-20 PF05057: DUF676" amino acids 17 to 95 (79 residues), 21.3 bits, see alignment E=4.2e-08 PF00975: Thioesterase" amino acids 18 to 106 (89 residues), 35.3 bits, see alignment E=3.6e-12 PF12697: Abhydrolase_6" amino acids 18 to 245 (228 residues), 61.5 bits, see alignment E=4.8e-20

Best Hits

Swiss-Prot: 50% identical to MENH_SERP5: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menH) from Serratia proteamaculans (strain 568)

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 56% identity to ebi:EbC_30510)

MetaCyc: 45% identical to 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. [EC: 4.2.99.20]

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>LU632_RS08110 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase (Erwinia tracheiphila SCR3)
MILHACWRGSHHNPRPVLVWLHGFLGSGEDWRSVQADFDGWPQLSIDLPGHSGSGDQRAG
DFDTLCTQLKATLAHHQVQRYWLIGYSLGGRLALYYACRHAQAGLQGVVVEGAHYGLASA
TAREQRLVHDRRWAAKFHHQPLKLTLEEWYQQSVFADLTVRQRDTLVSLRACHHPDALAC
ALLAMSLARQPFLLPELHRLPRLHFLCGERDHKFRQLTEQASLPLTVVPDAGHNAHRANP
SAFAAILAHQIINV