Protein Info for LU632_RS08025 in Erwinia tracheiphila SCR3

Name: nuoN
Annotation: NADH-quinone oxidoreductase subunit NuoN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 447 to 470 (24 residues), see Phobius details TIGR01770: proton-translocating NADH-quinone oxidoreductase, chain N" amino acids 9 to 475 (467 residues), 463.8 bits, see alignment E=3.8e-143 PF00361: Proton_antipo_M" amino acids 122 to 420 (299 residues), 288.1 bits, see alignment E=3.6e-90

Best Hits

Swiss-Prot: 89% identical to NUON_ERWT9: NADH-quinone oxidoreductase subunit N (nuoN) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00343, NADH dehydrogenase I subunit N [EC: 1.6.5.3] (inferred from 93% identity to ebi:EbC_30640)

MetaCyc: 83% identical to NADH:quinone oxidoreductase subunit N (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>LU632_RS08025 NADH-quinone oxidoreductase subunit NuoN (Erwinia tracheiphila SCR3)
MTITPQQLIALLPMLIVGLTVVVVMLSIAWRRNHFVNATLAVVGLNLALLSLFFVAKVGP
MDVTPLLRVDGYSMLYTGLVILASLATCTFAYPWLATYPDNREEFYLLALIAALGGVVLA
SANHLASMFIGIELISLPLFGLVGYAFQQKRSLEAGIKYTIMSAVASSFLLFGIALLYAD
SGNLSFVALGKSLNDTMVHQPLLLAGLGMMIVGLGFKLSLVPFHLWTPDVYQGAPAPVST
FLATASKIAIFGVVMRLFLYAPVANSESVRLVLAIIAFASILFGNLMAISQSNIKRLLGY
SSIAHLGYLLVALIAIQTHQLSLEAVGIYLAGYLFSSLGAFGVVSLMSSPYRGPDADSLY
SYRGLFWHRPILSAVMTVMLLSLAGIPMTLGFIGKFYVIAVGVGAHLWWLTGAVVVGSAI
GLYYYLRVTVSLYLTPPELLKRDTPANWAFTAGGVVVLISAVLVLLLGIYPQPLISLVQM
AQPLM