Protein Info for LU632_RS07390 in Erwinia tracheiphila SCR3

Annotation: Rpn family recombination-promoting nuclease/putative transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF04754: Transposase_31" amino acids 14 to 214 (201 residues), 284 bits, see alignment E=3.1e-89 TIGR01784: conserved hypothetical protein" amino acids 14 to 319 (306 residues), 197.9 bits, see alignment E=1.5e-62

Best Hits

Swiss-Prot: 60% identical to YTL2_SALTY: Recombination-promoting nuclease pSLT051 (PSLT051) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 65% identity to brh:RBRH_00687)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>LU632_RS07390 Rpn family recombination-promoting nuclease/putative transposase (Erwinia tracheiphila SCR3)
MSGRKGKGWKSPVPHDGLFKTFLTHTDTARDFLALHLPAELLQLCDLTTLQLESGSFIEE
NLRTYFADVLYSLKTTEGEGYIYTLIEHQSSPDRHMAFRLMRYSIAAMQKHLDAGHEQLP
LVIPLLFSHGRGSPWPYTLNWTELFASPGTARKLYTGDFPLIDVGAIDDDEIMKHRRMAL
LELMLKHAQTRDLAELTEHLVTLLIAGYTTDEQLVTLMNWMLQTGDTARPEAFLQELARR
SPQHEEILMTIAQRLEQKAREEGIQLGEQRGEQRGIEKGRSEGEREATLKIARTMLQSGI
DRNTVMAMTGLTEEDLQRITH