Protein Info for LU632_RS06480 in Erwinia tracheiphila SCR3

Name: rpoS
Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 47 to 329 (283 residues), 466.3 bits, see alignment E=4.1e-144 PF00140: Sigma70_r1_2" amino acids 56 to 87 (32 residues), 43 bits, see alignment 7.3e-15 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 91 to 318 (228 residues), 118 bits, see alignment E=3.3e-38 PF04542: Sigma70_r2" amino acids 94 to 163 (70 residues), 80.8 bits, see alignment E=9.9e-27 PF04539: Sigma70_r3" amino acids 174 to 249 (76 residues), 66.4 bits, see alignment E=4.1e-22 PF04545: Sigma70_r4" amino acids 263 to 316 (54 residues), 54.9 bits, see alignment 9.7e-19

Best Hits

Swiss-Prot: 93% identical to RPOS_ECOLI: RNA polymerase sigma factor RpoS (rpoS) from Escherichia coli (strain K12)

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 95% identity to ebi:EbC_35220)

MetaCyc: 93% identical to RNA polymerase sigma factor RpoS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>LU632_RS06480 RNA polymerase sigma factor RpoS (Erwinia tracheiphila SCR3)
MSQNTLKVHDLNEDAEFDENGAEVFDEKAFVGNDPADNDIAEDELLQQGATQRVLDATQL
YLGEIGYSPLLTAEEEVFFARRALRGDIPSRRRMIESNLRLVVKIARRYSNRGLALLDLI
EEGNLGLIRAVEKFDPEKGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLR
TARELAHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTTLLGGDSDKALLDILA
DEKDNGPEDCTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGSEIGLTR
ERVRQIQVEGLRRLREILQAQGLNIEALFCE