Protein Info for LU632_RS06470 in Erwinia tracheiphila SCR3

Annotation: protein-L-isoaspartate(D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00080: protein-L-isoaspartate O-methyltransferase
  • amino acids 2 to 207 (206 residues), 279.3 bits, E=1.2e-87
• PF01135: PCMT
  • amino acids 7 to 206 (200 residues), 243.6 bits, E=1.8e-76

Best Hits

Swiss-Prot: 86% identical to PIMT_ERWT9: Protein-L-isoaspartate O-methyltransferase (pcm) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 86% identity to ebi:EbC_35240)

MetaCyc: 77% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.77

Protein Sequence (208 amino acids)

>LU632_RS06470 protein-L-isoaspartate(D-aspartate) O-methyltransferase (Erwinia tracheiphila SCR3)
MVSRRIETLLSQLRQLGIDDERLLKAIEDVPRERFIDEAFEHKAWENTALPIGSGQTISQ
PYMVARMTSLLALTPTSRVLEIGTGSGYQTAILAHLVEHVYSVERIKGLQWQARRRLKQL
DLHNVSTRHGDGWLGWAARGPYDAIIVTAAPPEIPLDLMSQLKVGGLMVLPVGEEQQQLK
RVIRKAEEFVVEIIEPVRFVPLVKGELA