Protein Info for LU632_RS06410 in Erwinia tracheiphila SCR3

Annotation: phosphoadenylyl-sulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02057: phosphoadenosine phosphosulfate reductase
  • amino acids 21 to 242 (222 residues), 310.4 bits, E=9e-97
• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 34 to 243 (210 residues), 299.7 bits, E=1.4e-93
• PF01507: PAPS_reduct
  • amino acids 48 to 219 (172 residues), 190.5 bits, E=1.3e-60

Best Hits

Swiss-Prot: 82% identical to CYSH_ERWT9: Phosphoadenosine phosphosulfate reductase (cysH) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 85% identity to ebi:EbC_35370)

MetaCyc: 80% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (9/12 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Protein Sequence (243 amino acids)

>LU632_RS06410 phosphoadenylyl-sulfate reductase (Erwinia tracheiphila SCR3)
MAVLDLSELNALPKVERVMALAEINNHLDTLSATGRVIWALENLPGEAVLSSSFGVQAAV
SLHLVSRVTPGIPVILTDTGYLFPETYQFIDRLAEQLKLNLRVFRAEQSAAWQEARYGKL
WEQGVEGIERYNQINKVEPMNRAMKTLNAQTWFAGLRREQSDSRANLSVLAIQREVFKVL
PIIDWDNKQVYQYLKDNGLDYHPLWDQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECG
LHE