Protein Info for LU632_RS06105 in Erwinia tracheiphila SCR3

Name: rppH
Annotation: RNA pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 7 to 142 (136 residues), 95.4 bits, E=1.5e-31

Best Hits

Swiss-Prot: 91% identical to RPPH_ERWT9: RNA pyrophosphohydrolase (rppH) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 90% identity to srr:SerAS9_4013)

MetaCyc: 88% identical to RNA pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-; 3.6.1.-

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (174 amino acids)

>LU632_RS06105 RNA pyrophosphohydrolase (Erwinia tracheiphila SCR3)
MIDDDGYRPNVGIVICNGQGQVLWARRYGQHSWQFPQGGINPGETAEQAMYRELFEEVGL
HRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLLCNDADINMQTINTPE
FDGWRWVSFWYPVRQVVSFKRDVYRRVMKEFASVVMPLQENNGQRNAFYRRKRG