Protein Info for LU632_RS04735 in Erwinia tracheiphila SCR3

Annotation: fimbria/pilus outer membrane usher protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 PF13954: PapC_N" amino acids 16 to 103 (88 residues), 45.5 bits, see alignment E=8.1e-16 PF00577: Usher" amino acids 123 to 672 (550 residues), 429.8 bits, see alignment E=2e-132

Best Hits

KEGG orthology group: None (inferred from 66% identity to enc:ECL_04445)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (681 amino acids)

>LU632_RS04735 fimbria/pilus outer membrane usher protein (Erwinia tracheiphila SCR3)
MILNNDYKGSVFLDFQSDKPCLTRPLLEEWGVKSAVLDKLHWDTRACLSADSANAFDLQF
WYRPDANLLTLLFPQEAFSPQQNGVSTSRWDDGINALFVNYRLDVNNQRAQYRWDTPGTD
ATLALENGLNVGPWRMRYQNTFWREADRQHGSYSNSASVWRSITSMRSRLNLGDGYTSSN
LFDSMSYRGMSLASDEAMFPDSWRPYSPLINGYARSEAEVTLRQNGERVYRIHVPPGPFV
IRDFYPPDSQGNLELTIQESDGSERTRSIPYSIMPNLVQYKMFSYELVAGRYKPFHGVEL
EKDRFWQSTLSWGVAPRATVFGGVQQGENYVSHVVGLGGNMGKWGALSADVRNAHYSQQG
KAFSGSVGRMRYAKTFFQTETSLNAQLQWYPRGSQYRSLEERLNRSSVLAWGLDDTTTQR
TLESQVELTQNFDENSSLSLSWRWLKSRTRAAGSNSLTLSLDASWQDVDLSLYGSYDRYG
DYAPESTLGINISIPFSTGSHFTNVAWVSDLASRNKNTYGININGSALDDYSLRYDVTAE
HSEHGNDALKSSIGYQYNSGELNVSMTRSGTQRDYHGDVSGSVLVYQEGVVLGQTLGSTA
ALVQVPGSAKIGFYNQFGSTTNANGDLLVSYLTPWRVNRITVDSFSLPEGTDMDVNELET
VPTDGAIVNLRFLKPEKTEVR