Protein Info for LU632_RS04215 in Erwinia tracheiphila SCR3

Annotation: lysine exporter LysO family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 33 to 55 (23 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details PF03956: Lys_export" amino acids 112 to 291 (180 residues), 146.6 bits, see alignment E=3.3e-47

Best Hits

KEGG orthology group: None (inferred from 55% identity to epy:EpC_15850)

Predicted SEED Role

"FIG00634700: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>LU632_RS04215 lysine exporter LysO family protein (Erwinia tracheiphila SCR3)
MQESFISIALIFILLLSGYYTGKSVNDRLKSVILSQISNVVLLLLLCMGIDFGSVFTNKD
IGYSIIQNAIILSATITMATFFFLYKKKKVAVVKNREQSFLRPFKGCFRAFFAFSIGVGI
FRFTGFQLESIHFPSSIVLYVLIFLVGLDLVGVRVKKLTHDLVMVPVLTVLATVSAAAVC
SMFSHFSWRELLVVSSGFGWFSLSGPMVNRLVSPEMGAMAFMTDFFREMFSIIFLYFLGQ
TQPRGAIGISGAAALDSVLPFIKENCESTFISHAIVSGFILTVLVPFIISFSVTLL