Protein Info for LU632_RS04170 in Erwinia tracheiphila SCR3

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13637: Ank_4" amino acids 37 to 86 (50 residues), 29 bits, see alignment E=2.7e-10 amino acids 73 to 114 (42 residues), 23.4 bits, see alignment 1.5e-08 PF12796: Ank_2" amino acids 37 to 128 (92 residues), 51.1 bits, see alignment E=4.2e-17 amino acids 73 to 162 (90 residues), 47.4 bits, see alignment E=6.1e-16 PF13857: Ank_5" amino acids 58 to 103 (46 residues), 31.6 bits, see alignment E=4.3e-11 PF00023: Ank" amino acids 66 to 97 (32 residues), 25.1 bits, see alignment 3.9e-09 amino acids 98 to 130 (33 residues), 16.8 bits, see alignment 1.7e-06

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 65% identity to esc:Entcl_3774)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>LU632_RS04170 ankyrin repeat domain-containing protein (Erwinia tracheiphila SCR3)
MKALYLLLYLLAAPVLAAESPNHADEQQVKQQLNNYLWGAARSGDTAMLESFITAKYNLN
VQDERGYTAVILAAYHGHLAALEKLLSAGADPCLRDKHGNTALMGAIFKGEVKIAGRLIA
AKCNPDMRNNAGQTAAMYAALFQRQALLEQLKAKGADMQATDVNGNNIASLTRGEINGH