Protein Info for LU632_RS03695 in Erwinia tracheiphila SCR3

Annotation: PepSY domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 449 to 475 (27 residues), see Phobius details PF03929: PepSY_TM" amino acids 24 to 423 (400 residues), 207.3 bits, see alignment E=2.4e-65

Best Hits

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>LU632_RS03695 PepSY domain-containing protein (Erwinia tracheiphila SCR3)
MSEKTRARPARAVKAGGGLLPLLRRLHFYIGLFIAPFIFVAAFTGTLYVLTPQLENALYA
SQLYSALNGPARPLAEQITVAEKFIGPGVKIAAVRPAPHPGETTRVMFTTPLSGPSETTA
VFIAPDNLQVRGQLRVYGTSGILPLRTWLDYLHRNLLLGDLGRNYSELAASWLWVAAAGG
VLLWAGNRAPRKGKVDKKSREWRLLRSRYWHSKLGLVLMLGLIFFSATGLTWSRWAGENI
SAMRTHFGWQTPVVNTELVSRSPSTGDAMSQMMMPDGEVMAKNHAMMDEHAQHNMSGAIH
NEPGISVVPNQFDRVLNAARAAGIDAARIEIRPAWKANKAWTVSEIDHSWPTQVDSVAVD
PQHFQVVDKVEFARFGLLAKLTRWGIDAHMSVLFGLPNQLLLAFFSIGLCVMIVLGYRLW
WLRRPPTGHRHPAETLWYCWLLLSYPSRIMLVAVTFVLALSLPLMGISLLAMLAIDAIRW
QRAKHVVV