Protein Info for LU632_RS03240 in Erwinia tracheiphila SCR3

Name: sctC
Annotation: type III secretion system outer membrane ring subunit SctC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF03958: Secretin_N" amino acids 121 to 172 (52 residues), 31.5 bits, see alignment 2.6e-11 amino acids 179 to 303 (125 residues), 49.1 bits, see alignment E=8.2e-17 TIGR02516: type III secretion outer membrane pore, YscC/HrcC family" amino acids 246 to 519 (274 residues), 291.4 bits, see alignment E=5.1e-91 PF00263: Secretin" amino acids 362 to 518 (157 residues), 112.8 bits, see alignment E=2e-36 PF06586: TraK" amino acids 542 to 655 (114 residues), 32 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: K03219, type III secretion protein SctC (inferred from 84% identity to eam:EAMY_0549)

Predicted SEED Role

"Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (674 amino acids)

>LU632_RS03240 type III secretion system outer membrane ring subunit SctC (Erwinia tracheiphila SCR3)
MVEKSKSRCRLLGALLMLCTTLQAGAQTPSDWKEQSYAYSADHTPLSTVLQDFATGHGVD
LQLGNVEDTEITAKMRADNASAFLDRLALEHRFQWFVYNNTLYVSPQDEQSSERLEISPD
AAPDIKQALTGIGLLDPRFGWGELPDDGVVLVTGPPQYLELIKRFSEQREKKEDRRKVMT
FPLKYASVADRTIHYRDQTLVIPGVATMLNELMGGKHAAPTSANGSEAIMGAQDTNAMMQ
NTESLLARLSGRTNRANRTGDSSVDDLNGRISADVRNNALLIRDDNKRHDEYAQLIAKTD
VPQNLVEIDAVIMDIDRTALNRLEANWQATLGGVTGGTSLMSGSGTLFVSDFKRFFADIQ
TLEGEGTASIVANPSVLTLENQPAVIDFSQTAYITATGERVADIQPVTAGTSLQVTPRAV
GYQGHNAIQLMIDIEDGQLETNIDGQATGMKRGTVSTQALISENRALVLGGFHVEESGDR
ARRIPLLGDIPWIGKLFTSTRHEISQRQRLFILTPRLIGDQTDPTRYVTADNRQQLNDAM
ERVERRHGNVNMHDVIENAMRDLVERQTPAGFQQQLSGARLSEVCRQVPGLLFDGSRAQW
YSGSNGSVQLNVGVVRNITKKPLRFDESNCASRRTMAVAVWPGSTLAPGQSAEVYMALNP
NRVLTESRESLINH